SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001056 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001056
Domain Number 1 Region: 574-625
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 3.79e-16
Family Eferin C-derminal domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily EF-hand 0.0000000157
Family Calmodulin-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001056
Domain Number - Region: 329-403
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00484
Family Mitotic arrest deficient-like 1, Mad1 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001056   Gene: ENSGGOG00000001071   Transcript: ENSGGOT00000001080
Sequence length 626
Comment pep:known_by_projection chromosome:gorGor3.1:5:52666439:52816622:-1 gene:ENSGGOG00000001071 transcript:ENSGGOT00000001080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRINF
KDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCLEQGSEVTGPTFADGELIPREP
GFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLGGLFLPEDKSLV
HTPSMTTSDLSTHSTTSLVSNEEQFEDYGEGDDVDCAPSSPCPDDETRTNVYSDLGSSVS
SSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPNRKISSTAFGRQ
LMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLTNGDLKSKLKQE
NTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVELLNARVQQLEE
ENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQK
EREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQ
ENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDELMEALKEQEEIN
FRLRQYMDKIILAILDHNPSILEIKH
Download sequence
Identical sequences ENSGGOP00000001056 ENSGGOP00000001056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]