SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001068 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001068
Domain Number 1 Region: 126-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 37-102
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 425-477
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000144
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001068   Gene: ENSGGOG00000001083   Transcript: ENSGGOT00000001092
Sequence length 500
Comment pep:known_by_projection chromosome:gorGor3.1:19:1548914:1561249:-1 gene:ENSGGOG00000001083 transcript:ENSGGOT00000001092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKAL
RAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGTAQ
GPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPE
NVDRAREEIEAHITLRTGAFTDAGPDSDFHANGTDVCLDLLGAAASLWAKTPNPGRRPPT
ATAGLRGDTALGAPSAPEAFYAGSRGGXAEGPGAPVGTAAPDDCDFGFDFLALDLTVPAA
ATIWAPFERAAPLPAFSGCSTVNGAPGPPAAGARRSSGAGTPRHSPTLPEPGGLRLELPL
SRRGAPDPVGALSWRPPQGPVSFPGGAAFSTATSLPSSPAAAACAPLDSGASENNRKPPS
ASSAPALARECVVCAEGEVMAALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIRV
ETETPETPQPGGASALQRQY
Download sequence
Identical sequences ENSGGOP00000001068 ENSGGOP00000001068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]