SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001070 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001070
Domain Number 1 Region: 9-299
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.05e-81
Family Eukaryotic proteases 0.00057
Further Details:      
 
Domain Number 2 Region: 415-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 3 Region: 318-404
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000733
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001070   Gene: ENSGGOG00000001085   Transcript: ENSGGOT00000001094
Sequence length 548
Comment pep:known_by_projection chromosome:gorGor3.1:11:7737342:7752525:-1 gene:ENSGGOG00000001085 transcript:ENSGGOT00000001094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLISRNKLILLLGIVFFERGESATLSLPKAPSCGQSLVKVQHWNYFNIFSRILGGSQVEK
GSYPWQVSLKQRQKHICGGSIVSPQWVITAAHCVANRNIVSTLNVTAGEYDLSQTDPGEQ
TLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEAGLICTTAG
WGRLTEGGVLSQVLQEVNLPILTWEECAAALLTLKRPISGKTFLCTGFPDGGRDACQGDS
GGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFTDLSKVLPWIHEHIQT
GNQRKSSRAWCSEQDVIVSGAEGKLHFPESLHLYYESEQQCVWTLLVPEEMHVLLSFSHL
DVESCHHNYLSMYSLEDRPIGKFCGESLPSATDYEAGFNLTYKALKPNYIPDSGCSYLTV
LFEEGLIQSLNYPENYSDKANCDWIFQAPKHHLIKLSFQSLEIEESGDCTSDYVTVHSDV
ERKKEIARLCGYDVPTPVLSPSSIMLISFQSDENGTFRGFQATVSFIPKAGKKIESPTLW
LPVLILVM
Download sequence
Identical sequences ENSGGOP00000001070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]