SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001105 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000001105
Domain Number - Region: 150-201
Classification Level Classification E-value
Superfamily t-snare proteins 0.0651
Family t-snare proteins 0.012
Further Details:      
 
Domain Number - Region: 248-294
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0806
Family Myb/SANT domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001105   Gene: ENSGGOG00000001120   Transcript: ENSGGOT00000001129
Sequence length 304
Comment pep:known_by_projection chromosome:gorGor3.1:5:98372204:98398963:-1 gene:ENSGGOG00000001120 transcript:ENSGGOT00000001129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTTVVVAAAATAVAGAVAGAGAATGTGVGATPAPQQSDGCFSTSGGIRPFHLQNWKQ
KVNQTKKAEFVRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRERA
KIQQQLAKIHNNVKKLQHQLKDVKPTPDFVEKLREMMEEIENAINTFKEEQRLIYEELIK
EEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEEVLDFEKFLQQ
TGGRQGAWDDYDHQNFVKVRNKHKGKPPFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEE
RKKE
Download sequence
Identical sequences ENSGGOP00000001105 ENSGGOP00000001105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]