SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001199 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001199
Domain Number 1 Region: 215-412
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.86e-50
Family Reprolysin-like 0.0000412
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001199
Domain Number - Region: 429-462
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00013
Family Blood coagulation inhibitor (disintegrin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001199   Gene: ENSGGOG00000001215   Transcript: ENSGGOT00000001223
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:8:24306115:24326132:1 gene:ENSGGOG00000001215 transcript:ENSGGOT00000001223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKD
NQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPGGEEITTKPEN
MEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYLIKPLKSTDEKEHAVFTSNQEEQ
DPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTL
IRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNPGK
KIHDHAQLLSGISFNNRRAGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGM
PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT
PVCGNHLLEVEEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
Download sequence
Identical sequences G3QFW5
XP_004046837.1.27298 ENSGGOP00000001199 ENSGGOP00000019620 ENSGGOP00000001199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]