SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001239 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001239
Domain Number 1 Region: 126-181
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000259
Family SNARE fusion complex 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001239
Domain Number - Region: 5-118
Classification Level Classification E-value
Superfamily t-snare proteins 0.000143
Family t-snare proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001239   Gene: ENSGGOG00000001255   Transcript: ENSGGOT00000001263
Sequence length 226
Comment pep:novel chromosome:gorGor3.1:5:37148411:37170129:-1 gene:ENSGGOG00000001255 transcript:ENSGGOT00000001263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLYQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPP
NKRQNAKLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTANDSDTTIPM
DESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIEMGFLNVGQAGLELLTSGDPPTLASGISHRSR
Download sequence
Identical sequences ENSGGOP00000001239 ENSGGOP00000020798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]