SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001252 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001252
Domain Number 1 Region: 205-358,502-695
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 1.41e-29
Family Quinohemoprotein amine dehydrogenase B chain 0.045
Further Details:      
 
Domain Number 2 Region: 599-712,875-1102
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.29e-18
Family WD40-repeat 0.024
Further Details:      
 
Domain Number 3 Region: 68-271
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000366
Family WD40-repeat 0.0086
Further Details:      
 
Domain Number 4 Region: 389-551
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000302
Family WD40-repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001252   Gene: ENSGGOG00000001268   Transcript: ENSGGOT00000001276
Sequence length 1151
Comment pep:known_by_projection chromosome:gorGor3.1:3:50258101:50269809:1 gene:ENSGGOG00000001268 transcript:ENSGGOT00000001276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAARWEGSFSREFSSLLSRGCLRTLRVDMDALEDYVWPRATSELILLPVTGLECVGDR
LLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVQPEPNGDLDLEAMVAVFGSK
GLRVVKISWGQGHFRELWRSGLWNMSDWIWDARWLEGNIALALGHNSVVLYDPVVGCILQ
EVPCTDRCTLSSACLIGDAWKELTIVAGAVSNQLLVWYPATALADNKPVAPDRRISGHVG
IIFSMSYLESKGLLATASEDRSVRIWKVGDLRVPGGRVQNIGHCFGHSARVWQVKLLENY
LISAGEDCVCLVWSHEGEILQAFRGHQGRGIRAIAAHERQAWVITGGDDSGIRLWHLVGR
GYRGLGVSALCFRSRSRPGTLKAVTLAGSWRLLAVTDTGALYLYDVEVKCWEQLLEDKHF
QSYCLLEAAPGPEGFGLCAMASGEGRVKVVPINTPTAAVDQTLFPGKVHSLSWALRGYEE
LLLLASGPGGVVACLEISAAPSGKAIFVKERCRYLLPPSKQRWHTCSAFLPPGDFLVCGD
RRGSVLLFPSRPGLLKDPGVGGKAGAGAGAPVVGSGSSGGGNAFTGLGPVSTLPSLHGKQ
GVTSVTCHGGYVYTTGRDGAYYQLFVRDGQLQPVLRQKSCRGMNWLAGLRIVPDGSMVIL
GFHANEFVVWNPRSHEKLHIVNCGGGHRSWAFSDTEAAMAFAYLKDGDVMLYRALGGCTR
PHVILREGLHGREITCVKRVGTITLGPEYGVPSFMQPDDLEPGSEGPDLTDIVITCSEDT
TVCVLALPTTTGSAHALTAVCNHISSVRAVAVWGIGTPGGPQDPQPGLTAHVVSAGGRAE
MHCFSIMVTPDPSTPSRLACHVMHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCEL
DQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRL
LLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLP
TREGHHLVASGSEDGSLHVFMLAVEMLELEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTG
LKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALG
GQGLEVYNWYD
Download sequence
Identical sequences G3QG03
ENSGGOP00000001252 XP_004034157.1.27298 ENSGGOP00000001252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]