SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001279 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000001279
Domain Number - Region: 41-230,262-325
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00051
Family Glycerol-3-phosphate (1)-acyltransferase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001279   Gene: ENSGGOG00000001296   Transcript: ENSGGOT00000001304
Sequence length 337
Comment pep:known_by_projection chromosome:gorGor3.1:X:67406478:67436633:1 gene:ENSGGOG00000001296 transcript:ENSGGOT00000001304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFFSRLDLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDW
NTHSQGGRRSAWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINF
ATEATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKGSGNAV
VIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGT
WLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPN
QKTVDKYHALYISALRKLFDQHKVEYGLPETQELTII
Download sequence
Identical sequences G3QG27
ENSGGOP00000001279 XP_004064372.1.27298 ENSGGOP00000001279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]