SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001284 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001284
Domain Number 1 Region: 995-1101
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-27
Family PDZ domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 281-388
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-25
Family PDZ domain 0.00000428
Further Details:      
 
Domain Number 3 Region: 773-880
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-23
Family PDZ domain 0.00000971
Further Details:      
 
Domain Number 4 Region: 628-731
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-22
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 5 Region: 2-122
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.08e-20
Family Nucleotide and nucleoside kinases 0.007
Further Details:      
 
Domain Number 6 Region: 455-560
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-19
Family PDZ domain 0.0000126
Further Details:      
 
Domain Number 7 Region: 169-206
Classification Level Classification E-value
Superfamily WW domain 0.000000000000653
Family WW domain 0.0013
Further Details:      
 
Domain Number 8 Region: 216-251
Classification Level Classification E-value
Superfamily WW domain 0.00000000181
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001284   Gene: ENSGGOG00000001298   Transcript: ENSGGOT00000001309
Sequence length 1105
Comment pep:known_by_projection chromosome:gorGor3.1:7:75126724:75682927:-1 gene:ENSGGOG00000001298 transcript:ENSGGOT00000001309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDNLYLQAICTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPA
EPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVT
PESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEM
AYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHI
NRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQLKGTFLSTTLK
KSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVV
KLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEY
ISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVK
GAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP
IGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPD
STEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGF
RILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR
NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEG
FASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLK
VGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQ
SPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTD
YRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDM
EKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARA
IELIKSGGRRVRLLLKRGTGQVPEY
Download sequence
Identical sequences ENSGGOP00000001284 ENSGGOP00000001284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]