SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001285 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001285
Domain Number 1 Region: 170-290
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.59e-37
Family Nuclear movement domain 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001285   Gene: ENSGGOG00000001301   Transcript: ENSGGOT00000001310
Sequence length 360
Comment pep:known_by_projection chromosome:gorGor3.1:7:45355822:45469953:-1 gene:ENSGGOG00000001301 transcript:ENSGGOT00000001310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGAAELYDQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLRHPSDRMGFPPGAAQA
LVLQVFKTFDHMARQDDEKRRQELEEKIRRKEEEAKTVSAAAAEKEPVPIPVQEIEIDST
TELGGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAEVPREPPVLPRIQEQFQKNPDS
YNGAVRENYTWSQDYTDLEVRVPVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGK
LTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGEEPIDIDKINKERSMATVDEEE
QAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQRFDPAMFNISPGAVQF
Download sequence
Identical sequences G3QG33
ENSGGOP00000001285 XP_004045426.1.27298 ENSGGOP00000001285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]