SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001308 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001308
Domain Number 1 Region: 57-82,127-168
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000069
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 167-210
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000418
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001308   Gene: ENSGGOG00000001324   Transcript: ENSGGOT00000001333
Sequence length 327
Comment pep:known_by_projection chromosome:gorGor3.1:4:195840118:195841987:1 gene:ENSGGOG00000001324 transcript:ENSGGOT00000001333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKVSRLSPNGTCALVVEASDSPSRHLGGPMAGKCPHGTLSVEESRVRTPVSHK
VIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPAQQALGR
CEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECM
KNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLQEPDFSYQLHPAGPE
FAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGL
DRHYLNLIGHAHPNALNLHTPQHPPVL
Download sequence
Identical sequences G3QG56
ENSGGOP00000001308 ENSGGOP00000001308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]