SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001313 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001313
Domain Number 1 Region: 62-94,146-209
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-23
Family Voltage-gated potassium channels 0.0053
Further Details:      
 
Domain Number 2 Region: 218-342
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-21
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001313   Gene: ENSGGOG00000001329   Transcript: ENSGGOT00000001338
Sequence length 439
Comment pep:known_by_projection chromosome:gorGor3.1:11:61103561:61111165:1 gene:ENSGGOG00000001329 transcript:ENSGGOT00000001338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHASVHTRVRGLWVPWRGRHAHGGRGCRGVCGVCRWVTTAPQEPPARPLQAGSGAGLAPG
RAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQEL
GLLIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRL
FCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLI
GCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFW
ILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQEKEQPLLPPP
PCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRG
RRRPNPPRKPGPRDKGVPV
Download sequence
Identical sequences ENSGGOP00000018574 ENSGGOP00000001313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]