SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001367
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.01e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000846
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000143
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001367   Gene: ENSGGOG00000001381   Transcript: ENSGGOT00000001392
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:9:79748851:79771408:-1 gene:ENSGGOG00000001381 transcript:ENSGGOT00000001392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEAAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Download sequence
Identical sequences G3QGB4
ENSGGOP00000001367 XP_004048375.1.27298 ENSGGOP00000001367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]