SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001369 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001369
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 1.63e-43
Family Globins 0.0000000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001369   Gene: ENSGGOG00000001385   Transcript: ENSGGOT00000001394
Sequence length 190
Comment pep:known_by_projection chromosome:gorGor3.1:5:6683988:6693066:1 gene:ENSGGOG00000001385 transcript:ENSGGOT00000001394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFANDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Download sequence
Identical sequences A0A2I2YA07 A0A2J8Y1E4
ENSGGOP00000001369 XP_004040948.1.27298 ENSGGOP00000001369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]