SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001374 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001374
Domain Number 1 Region: 49-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-72
Family Lectin leg-like 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001374   Gene: ENSGGOG00000001391   Transcript: ENSGGOT00000001399
Sequence length 359
Comment pep:known_by_projection chromosome:gorGor3.1:2a:94214152:94249998:-1 gene:ENSGGOG00000001391 transcript:ENSGGOT00000001399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAILGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKP
YQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQ
GKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQEAQKRRYSPGVQ
RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDID
GKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDV
FLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY
Download sequence
Identical sequences ENSGGOP00000001374 ENSGGOP00000001374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]