SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001404 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001404
Domain Number 1 Region: 91-264
Classification Level Classification E-value
Superfamily HAD-like 5.36e-57
Family NLI interacting factor-like phosphatase 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001404   Gene: ENSGGOG00000023706   Transcript: ENSGGOT00000001430
Sequence length 282
Comment pep:known_by_projection chromosome:gorGor3.1:12:55997182:56031546:-1 gene:ENSGGOG00000023706 transcript:ENSGGOT00000001430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELA
AYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPI
NNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRC
GVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDM
ADTELLNLIPIFEELSGAEDVYTSLGAAGPLACPASKRRPSQ
Download sequence
Identical sequences ENSGGOP00000001404 ENSGGOP00000001404 ENSP00000480551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]