SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001460 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001460
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-19
Family Fibronectin type II module 0.0032
Further Details:      
 
Domain Number 2 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-16
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 3 Region: 118-169
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000771
Family Fibronectin type II module 0.0038
Further Details:      
 
Domain Number 4 Region: 27-71
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000685
Family Fibronectin type II module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001460   Gene: ENSGGOG00000001477   Transcript: ENSGGOT00000001487
Sequence length 223
Comment pep:known_by_projection chromosome:gorGor3.1:19:45262810:45277591:1 gene:ENSGGOG00000001477 transcript:ENSGGOT00000001487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYN
GQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSLLGSLWCSVTSVFDEKQQWKFCETNEY
GGNSLSKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGF
PCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
Download sequence
Identical sequences ENSGGOP00000001460 ENSGGOP00000001460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]