SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001472 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001472
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-40
Family Pentraxin (pentaxin) 0.00000000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001472   Gene: ENSGGOG00000001492   Transcript: ENSGGOT00000001499
Sequence length 223
Comment pep:known_by_projection chromosome:gorGor3.1:1:138591222:138592266:1 gene:ENSGGOG00000001492 transcript:ENSGGOT00000001499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS
DLSRAYSLFSYNTQGRDNELLVYKERIGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESS
SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDKSQSFVGEIGDLYMWD
SVLAPENILSAYQGTPLPANILDWRALNYEIRGYVIIKPLVWV
Download sequence
Identical sequences G3QGL3
XP_004027117.1.27298 ENSGGOP00000001472 ENSGGOP00000001472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]