SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001486 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001486
Domain Number 1 Region: 306-334
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000492
Family LIM domain 0.0017
Further Details:      
 
Domain Number 2 Region: 279-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000678
Family LIM domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001486
Domain Number - Region: 394-436
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00361
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001486   Gene: ENSGGOG00000001505   Transcript: ENSGGOT00000001514
Sequence length 477
Comment pep:known_by_projection chromosome:gorGor3.1:7:98383097:98388916:1 gene:ENSGGOG00000001505 transcript:ENSGGOT00000001514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGVLQRTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYATASTPAGPAFPVQVKVAQPVRG
CGPPRRGGSQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGGGRGG
EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVYRPSRCYCLSFILFDIIPSPRPKAIPL
ASLIPSCAPPSLGSIVGALQPQGLMAFLVLFPCRKFAPRCSVCGGAIMPEPGQEETVRIV
ALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Download sequence
Identical sequences ENSGGOP00000001486 ENSGGOP00000001486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]