SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001495 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001495
Domain Number 1 Region: 73-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001495   Gene: ENSGGOG00000001516   Transcript: ENSGGOT00000001524
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:6:138238075:138238878:-1 gene:ENSGGOG00000001516 transcript:ENSGGOT00000001524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDSSSVSSRASSPDMDEMYLRESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKY
KIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLA
RNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVQPVHPILGGALS
SGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPP
HLSALSTANMARLSAESK
Download sequence
Identical sequences ENSGGOP00000001495 ENSGGOP00000001495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]