SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001534 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001534
Domain Number 1 Region: 218-458
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-48
Family Voltage-gated potassium channels 0.0015
Further Details:      
 
Domain Number 2 Region: 60-165
Classification Level Classification E-value
Superfamily POZ domain 3.92e-27
Family Tetramerization domain of potassium channels 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001534   Gene: ENSGGOG00000001556   Transcript: ENSGGOT00000001565
Sequence length 519
Comment pep:known_by_projection chromosome:gorGor3.1:16:74744726:74762712:-1 gene:ENSGGOG00000001556 transcript:ENSGGOT00000001565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMPSRDRGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKE
ILINVGGRRYLLPWSTLDQFPLSRLSKLRLCRSYEEIAQLCDDYDEDSQEFFFDRSPSAF
GVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHR
EDVLRQQRETRRLASHSSRWGLCMNRLREMVENPQSGLPGKVFACLSILFVATTAVSLCV
STMPDLRAEEDQGQCSRKCYYIFIVETICVAWFSLEFCLRFVQAQDKCQFFQGPLNIIDI
LAISPYYVSLAVSEEPPEDGERLSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTL
GLTVRRCTREFGLLLLFLAVAVTLFSPLVYMAEKESGRVLEFTSIPASYWWAIISMTTVG
YGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQARLRHLQN
TGPASECELLDPHVASEHELMNDVNDLILEGPALPIMHM
Download sequence
Identical sequences ENSGGOP00000001534 ENSGGOP00000001534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]