SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001590
Domain Number 1 Region: 216-326
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.82e-26
Family Dual specificity phosphatase-like 0.0000492
Further Details:      
 
Domain Number 2 Region: 344-416
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000085
Family PLC-like (P variant) 0.012
Further Details:      
 
Domain Number 3 Region: 74-210
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000126
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001590   Gene: ENSGGOG00000001612   Transcript: ENSGGOT00000001624
Sequence length 417
Comment pep:known_by_projection chromosome:gorGor3.1:13:996716:1094623:-1 gene:ENSGGOG00000001612 transcript:ENSGGOT00000001624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSPQTNEFKGTTEEAPVKESPHTSEFKGAALVSPISKSMLERLSKFEVEDAENVASYD
SKIKKIVHSIVSSFAFGIFGVFLVLLDVTLLLADLIFTDSKLYIPLEYRSISLAIALFFL
MDVLLRVFVEGRQQYFSDLFNILDTAIIVIPLLVDVIYIFFDIKLLRNIPRWTHLVRLLR
LIILIRIFHLLHQKRQLEKLMRRLVSENKRRYTRDGFDLDLTYITERIIAMSFPSSGRQS
FYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVGRIMIDDHNVPTLHEMVAF
TKEVNEWMAQDLENIVAIHCKGGKNRYVGYFAHVKHLYNWNLPPRRILFIKRLIIYSIRG
DVCDLKVQVVMEKKVVFSSTSLGNCLILHDIETDKVLIDVFDGPPLYDDVKVQFFSL
Download sequence
Identical sequences ENSGGOP00000001590 ENSGGOP00000000982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]