SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001638 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001638
Domain Number 1 Region: 328-383
Classification Level Classification E-value
Superfamily CCCH zinc finger 4.71e-20
Family CCCH zinc finger 0.00026
Further Details:      
 
Domain Number 2 Region: 300-326
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000034
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 273-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000196
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001638   Gene: ENSGGOG00000001665   Transcript: ENSGGOT00000001674
Sequence length 1189
Comment pep:known_by_projection chromosome:gorGor3.1:2a:110085506:110148534:1 gene:ENSGGOG00000001665 transcript:ENSGGOT00000001674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSEHAGHDREDGELEDGEIDDAGFEEIQEKEAKENEKQKSEKAYRKSRKKHKKEREKK
KSKRRKREKHKHNSPSSDDSSDYSLDSDVEHTESSHKKRTGFYRDYDIPFTQRGHISGSY
ITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKET
SNIALGSSFSKESGKKQRMKGVQQGIEQRVKSFNVGRGRGLPKKIKRKERGGRTNKGPNV
FSVSDDFQEYNKPGKKWKVMTQEFINQHTVEHKGKQICKYFLEGRCIKGDQCKFDHDAEL
EKRKEICKFYLQGYCTKGENCIYMHNEFPCKFYHSGAKCYQGDNCKFSHDDLTKETKKLL
DKVLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLPTPPEHFPFSDPEDDFQTDFS
DDFRKIPSLFEIVVKPTVDLAHKIGRKPPAFYNSASPPGPQFQGSSPHPQHIYSSGSSPG
PGPNMSQGHSSPVMHPGSPGHHPCAGPPGLPVPQSPPLPPGPPEIVGPQNQAGVLVQPDT
SLTPPSMGGAYHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDN
YYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPNHGSGSDGSSTRTGHGPLPVPGL
LPAVQRALFVRLTQRYQEDEEQTSTQPHRAPSKEEDDTVNWYSSSEEEEGSSVKSILKTL
QKQTETLRNQQQPSTELSTPTDPRLAKEKSKGNQVVDPRLRTIPRQDIRKPSESAPLDLR
LAWDPRKLRGNGSGHIGSSVGGAKFDLHHANAGTNVKHKRGDDDDEDTERELREKAFLIP
LDASPGIMLQDPRSQLRQFSHIKMDITLTKPNFAKHIVWAPEDLLPVPLPKPDPVSSINL
PLPPLIADQRLNRLWNTKSDLHQNTVSIDPKLAAKAKINTTNREGYLEQFGDSHGSGAKL
GDPRLQKNFDPRLHRLPNTESHQVVMKDSHTSKGAPHLSRSNPGSSQPSGAGTSNSGSGA
LPPYAPKLSSSAGLPLGTSTSVLSGISLYDPRDHGSSSTSELATASSGENSKNQKKSGGL
KSSDKNEPSPGEAILPQKTNPNVEVTLDGPADPQADVPRSSGKVQVPAVHSLPVQALTGL
IRPQYSDPRQARQPGQGSPTPDNDPGREADDKSLKEVFKTFDPTASPFC
Download sequence
Identical sequences G3SEF8
ENSGGOP00000001638 XP_004031658.1.27298 ENSGGOP00000001638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]