SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001656 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001656
Domain Number 1 Region: 4827-5042
Classification Level Classification E-value
Superfamily GFP-like 5.86e-62
Family Domain G2 of nidogen-1 0.0008
Further Details:      
 
Domain Number 2 Region: 2431-2530
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-25
Family I set domains 0.0085
Further Details:      
 
Domain Number 3 Region: 2350-2438
Classification Level Classification E-value
Superfamily Immunoglobulin 9.64e-25
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 3198-3299
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-24
Family I set domains 0.005
Further Details:      
 
Domain Number 5 Region: 1121-1218
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-24
Family I set domains 0.0077
Further Details:      
 
Domain Number 6 Region: 3573-3672
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 7 Region: 4031-4128
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-24
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 3008-3110
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-24
Family I set domains 0.0085
Further Details:      
 
Domain Number 9 Region: 2539-2626
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 10 Region: 2836-2924
Classification Level Classification E-value
Superfamily Immunoglobulin 4.44e-23
Family I set domains 0.0063
Further Details:      
 
Domain Number 11 Region: 2916-3015
Classification Level Classification E-value
Superfamily Immunoglobulin 5.3e-23
Family I set domains 0.0051
Further Details:      
 
Domain Number 12 Region: 2637-2725
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 3936-4035
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-23
Family I set domains 0.033
Further Details:      
 
Domain Number 14 Region: 2256-2344
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 15 Region: 603-700
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 16 Region: 4304-4403
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-22
Family I set domains 0.0096
Further Details:      
 
Domain Number 17 Region: 1404-1505
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 18 Region: 3665-3763
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 19 Region: 2746-2828
Classification Level Classification E-value
Superfamily Immunoglobulin 7.22e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 1043-1134
Classification Level Classification E-value
Superfamily Immunoglobulin 7.64e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 3859-3951
Classification Level Classification E-value
Superfamily Immunoglobulin 8.58e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 22 Region: 786-885
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 2059-2154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 24 Region: 1778-1877
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 25 Region: 1323-1412
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 26 Region: 4121-4219
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 27 Region: 3104-3203
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 28 Region: 3757-3856
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-21
Family I set domains 0.0056
Further Details:      
 
Domain Number 29 Region: 4207-4305
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 30 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 8.9e-21
Family Integrin A (or I) domain 0.026
Further Details:      
 
Domain Number 31 Region: 1499-1598
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-20
Family I set domains 0.0039
Further Details:      
 
Domain Number 32 Region: 1965-2064
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 33 Region: 1702-1785
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 34 Region: 3492-3579
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 35 Region: 3400-3486
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-20
Family I set domains 0.0092
Further Details:      
 
Domain Number 36 Region: 4387-4484
Classification Level Classification E-value
Superfamily Immunoglobulin 7.25e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 37 Region: 1234-1318
Classification Level Classification E-value
Superfamily Immunoglobulin 8.47e-20
Family I set domains 0.0057
Further Details:      
 
Domain Number 38 Region: 518-618
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-19
Family I set domains 0.053
Further Details:      
 
Domain Number 39 Region: 3309-3392
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 40 Region: 1886-1971
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 41 Region: 1591-1692
Classification Level Classification E-value
Superfamily Immunoglobulin 3.64e-19
Family I set domains 0.0044
Further Details:      
 
Domain Number 42 Region: 2148-2249
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-18
Family I set domains 0.0084
Further Details:      
 
Domain Number 43 Region: 701-799
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 44 Region: 938-1031
Classification Level Classification E-value
Superfamily Immunoglobulin 3.2e-17
Family I set domains 0.0082
Further Details:      
 
Domain Number 45 Region: 5048-5193
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 46 Region: 4596-4654
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00017
Further Details:      
 
Domain Number 47 Region: 4484-4540
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000109
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 48 Region: 4539-4597
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000123
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 49 Region: 4768-4825
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000126
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 50 Region: 4654-4711
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000628
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 51 Region: 4710-4768
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000785
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 52 Region: 5193-5311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 53 Region: 5368-5484
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 54 Region: 888-940
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000486
Family I set domains 0.049
Further Details:      
 
Domain Number 55 Region: 430-521
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000811
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001656   Gene: ENSGGOG00000001656   Transcript: ENSGGOT00000001692
Sequence length 5592
Comment pep:known_by_projection chromosome:gorGor3.1:1:165355538:165808578:1 gene:ENSGGOG00000001656 transcript:ENSGGOT00000001692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWEVVHAVFLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHDVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPMIEIRNPLGKLIKKRFGLHELLNIHNSAKVVNVKEPEAGMWTVK
ISSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSS
VSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYLKESA
SVNLDIEKVTLSDKGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERAVLT
CLIISAVDYNLTWQRNDRDVRLAEPARIRTLANLSLELKSVKFNDAGEYHCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDMFIVGSHRYRM
TSDGTLFIKNAAPKDAGIYGCLASNSAGRDKQNSTLRYIEAPKLMVVQSELLVALGDITV
MECKTSGIPPPQVKWFKGDLELRSSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGR
ATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFS
VSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLLLQNPYITVRSDG
SLHIERVQLQDGGEYTCVASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCK
ASGIPKPSVIWSKKGELISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRK
VQLTVYVRPRVFGDQRGLSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPF
SPRHTFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQ
VGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQAMPSDAGIYTCVA
TNIAGTDETEITLHVQEPPTVEDLEPPYNTPFQERVANQRIAFPCPAKGTPKPTIKWLHN
GRELTGREPGISILEDGTLLVIASVTPYDSGEYICVAVNEAGTTEIKYNLKVHVPPVIKD
KEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTESSTIQIVNNGKILKLFKATP
EDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVTLECQVKGTPFP
DIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIY
IPPSIKGGNVTTDISVLINSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYL
HIPRAQVSDSATYVCHVANVAGTAEKSFHVDVYVPPMIEGNLATPLNKQVVIAHSLTLEC
KAAGNPSPILTWLKDGVPVKANDNIRIEAGGKKLEIMSAQEIDRGQYICVATSVAGEKEI
KYEVDVLVPPAIEGGDETSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQSIDERDGFKI
LLNGRKLVVAQAQVSDTGLYRCMAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKP
VALQCIANGIPNPSITWLKDDQPVNTAQGNLKIQSSGRLLQIAKTLLEDAGRYTCVATNA
AGETQQHIQLHVHEPPSLEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSG
STSMIFLNRGQIIDIESAQISDAGIYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAV
VVNNPVRLECEARGIPAPSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTC
VAVNAAGEKQRDIDLRVYVPPNIVGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHP
LLKKPGLSISENGSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDEL
TQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSD
TALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPT
VTWMKDGRPLIKAKGVEILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAP
PSIIGNHRSPENISVVEKNSVTLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLR
LMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEV
TGNPVPEITWHKDGQPLQEDEAHHIISGGRFLQITNVQVPHTGRYTCLASSPAGDKSRSF
SLNVFVSPTIAGVGSDGNPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIR
ILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKE
VKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRY
TCVASNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNA
APPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDV
RVLVPPIIKGANSDLPEEVTVLVNKSALMECLSSGSPAPRNSWQKDGQPLLEDDHHKFLS
NGRILQILNTQITDIGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFIS
LTCEVSGFPPPDLSWLKNEQPIKLNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGE
SKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITES
THVEILADGQMLHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVE
TISNPVTLTCDATGIPPPTIAWLKNRKRIENSDSLEVHILSGGSKLQIARSQHSDSGNYT
CIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKD
GKPIASGETERIRVSANGSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIR
GNKDEAEKLMTFVDTSINIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRA
QVSDVAVYTCVASNRAGVDNKHYNLQVFAPPNMDNSMGTEEITILKGTSTSMACITDGTP
APSMAWLRDGQPLGLDAHLTVSTHGMVLQLVKAETEDSGKYTCIASNEAGEVSKHFILKV
LEPPHINGSEEHEEISVIVNNPLELTCIASGIPAPKMTWMKDGRPLPQTDQVQTLGGGEV
LRISTAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTDEPQDITVLRNRQVTLEC
KSDAVPPPVITWLRNGEWLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTR
EFILTVNVPPNIKGGPQSLVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSIL
ENGFLHIQSAHVTDTGRYLCMATNAAGTDRRRIDLQVHVPPSVAPGPTNMTVTVNVQTTL
ACEATGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAG
DDKRTVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDG
YRILSSGAIEILATQLNHAGRYTCVARNAAGSAHRHVILHVHEPPVIQPQPSELHVILNN
PILLPCEATGTPSPFITWQKEGINVNTSGRNHAVLPSGGLQISRAVREDAGTYMCVAQNP
AGTALGKIKLNVQVPPVISPHLKEYVIAVDKPITLSCEADGLPPPDITWHKDGRAIVESI
RQRVLSSGSLQIAFVQPGDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNEN
SQAILPCVADGIPTPAINWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANN
AAGEDTHTVSLTVHVLPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIPAH
FDSVNGHSELVIERVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPL
GGNAILNCEVKGDPTPTIQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATN
EAGVVERSMSLTLQSPPVITLEPVETVINAGGKIILNCQATGEPQPTITWSRQGHSISWD
DRVNVLSNNSLYIADAQKEDTSEFECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRACSV
TCGKGIQKRSRLCNQPLPANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCG
RGNRTRTRTCNNPSVQHGGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGT
QTRARLCNNPPPAFGGSYCDGAETQMQVCNERHCPIHGKWATWASWSACSVSCGGGARQR
TRDCSDPVPQYGGRKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRMCNGGQMRRYRT
CDNPPPSNGGRACGGPDSQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDH
PVPVKGGHPCPGDTTQVTRCNVQACPGGPQRARGSVIGNINDVEFGIAFLNATITDSPNS
DTRIIRAKITNVPRSLGSAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEF
ATGEILQMSHIARGLDSDGALLLDIVVSGYVLQLQSPAEVTVKDYTEDYIQTGPGQLYAY
STRLFTIDGISIPYTWNHTVFYDQAQGRMPFLVETLHASSVESDYNQIEETLGFKIHASI
SKGDRSNQCPSGFTLDSVGPFCADEDECAAGNPCSHTCHNAMGTYYCSCPKGLTIAADGR
TCQDIDECALGRHTCHAGQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQESSPCH
QRCFNAIGSFHCGCEPGYQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMT
KAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDINECEQVP
KPCAHQCSNTPGSFKCICPPGQHLLGDGKSCAGLERLPNYGTQYSSYNLARFSPVRNNYQ
PQQHYRQYSHLYSSYSEYRNSRTSLSRTRRTIRKTCPEGSEASHDTCVDIDECENTDACQ
HECKNTFGSYQCICPPGYQLTHNGKTCQDIDECLEQNVRCGPNRMCFNMRGSYQCIDTPC
PPNYQRDPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQDGVM
HPRTTFLMVDEEQTVPFALRDENLKGVVYTTRPLREAETYRMRVRASSYSANGTIEYQTT
FIVYIAVSAYPY
Download sequence
Identical sequences ENSGGOP00000001656 ENSGGOP00000001656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]