SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001666 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001666
Domain Number 1 Region: 311-392
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001666   Gene: ENSGGOG00000001693   Transcript: ENSGGOT00000001703
Sequence length 394
Comment pep:known_by_projection chromosome:gorGor3.1:1:41214567:41221178:-1 gene:ENSGGOG00000001693 transcript:ENSGGOT00000001703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCAGCRAAPSRRGAGPLQVAGGGSEGADMDYDSYQHYFYDYDCGEDFYRSTAPSEDIW
KKFELVPSPPTSPPWGLGPGAGDLAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASII
RRDCMWSGFSARERLERAVSDRLAAGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE
PKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCMKHFHISIHQQ
QHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHP
KPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYL
QALVGAEKRMATEKRQLRCRQQQLQKRIAYLSGY
Download sequence
Identical sequences G3QH47
ENSGGOP00000001666 ENSGGOP00000001666 XP_004025571.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]