SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001686 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001686
Domain Number 1 Region: 51-108
Classification Level Classification E-value
Superfamily GLA-domain 6.39e-20
Family GLA-domain 0.00068
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001686
Domain Number - Region: 164-173
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0458
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001686   Gene: ENSGGOG00000001713   Transcript: ENSGGOT00000001724
Sequence length 202
Comment pep:known_by_projection chromosome:gorGor3.1:19:46920764:46930911:1 gene:ENSGGOG00000001713 transcript:ENSGGOT00000001724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGHPSLLLLYMALTTCLDTSPSGETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTP
GNLERECLEERCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVAGLAVGLTCGILL
IVLAGLGAFWYLHWRRRRGQQPCPQEAGLISLLSPLSPLGPPTPLPPPPPPPPGLPTYEQ
ALAASGVHDAPPPPYTSLRRPH
Download sequence
Identical sequences G3QH64
ENSGGOP00000001686 XP_004061218.1.27298 ENSGGOP00000001686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]