SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001687 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001687
Domain Number 1 Region: 219-370
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.68e-27
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 70-103,153-211
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-24
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001687   Gene: ENSGGOG00000001715   Transcript: ENSGGOT00000001725
Sequence length 543
Comment pep:known_by_projection chromosome:gorGor3.1:14:69721437:69813892:-1 gene:ENSGGOG00000001715 transcript:ENSGGOT00000001725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGFKGDRTEGCRNDSVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARM
EGTSQGGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRD
HVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAP
STEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVIS
TILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREW
YKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETR
RRLSVEIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQES
INNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKT
FRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAEMENGMIPTDTKDRELENNSLLE
DRN
Download sequence
Identical sequences A0A2I2ZNH5
ENSGGOP00000001687 ENSGGOP00000001687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]