SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001692 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001692
Domain Number 1 Region: 282-524
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 1.02e-81
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0000000158
Further Details:      
 
Domain Number 2 Region: 7-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.19e-70
Family G proteins 0.00000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001692   Gene: ENSGGOG00000001719   Transcript: ENSGGOT00000001730
Sequence length 536
Comment pep:known_by_projection chromosome:gorGor3.1:1:91529143:91544413:-1 gene:ENSGGOG00000001719 transcript:ENSGGOT00000001730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEINLPGPLSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAI
LLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTL
RDFTLELEVDGEPITADDYLEHSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPA
PKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLELLDLH
RDSEREAIEVFMKNSFKDVDQIFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGP
LEEDVKQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQ
TDQSLSEKEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMER
DRAQFLEEEEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLDPICNIL
Download sequence
Identical sequences ENSGGOP00000001692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]