SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001705 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001705
Domain Number 1 Region: 400-447,504-703
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.62e-77
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000917
Further Details:      
 
Domain Number 2 Region: 41-131
Classification Level Classification E-value
Superfamily BRCT domain 9.29e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.059
Further Details:      
 
Domain Number 3 Region: 708-822
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 2.16e-16
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001705   Gene: ENSGGOG00000001728   Transcript: ENSGGOT00000001743
Sequence length 1251
Comment pep:known_by_projection chromosome:gorGor3.1:2a:96808173:96889709:-1 gene:ENSGGOG00000001728 transcript:ENSGGOT00000001743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGWRKRAENDGWETWGGYMAAKVQKLEEQFRSDAAMQKDGTSSTIFSGVAIYVNGYT
DPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKA
GRLLSYIPYQLYTKQSSVQKGLSFNPVCRPEDPLPGPSNIAKQLNNRVNHIVKKIETENE
VKVNGMNSWNEEDENNDFSFVDLEQTSPGRKQNGIPHPRGSTAIFNGHTPSSNGALKTQD
CLVPMVNSVASRLSPASSQEEDKAEKSSTDFRDCTLQQLQQSTRNTDALRNPHRTNSFSL
SPLHSNTKINGAHHSTVQGPSSTKSTSSVSTFSKAAPSVPSKPSDCNFISNFYSHSRLHH
ISMWKCELTEFVNTLQRQSNGIFPGREKLKKMKTGRSALVVTDTGDMSVLNSPRHQSCIM
HVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAA
DIPDSSLWENPDSAQANGIDSVLSRAEIASCSYEARQLGIKNGMFFGHAKQLCPNLQAVP
YDFHAYKEVAQTLYETLASYTHNIEAVSCDEALVDITEILAETKLTPDEFANAVRMEIKD
QTKCAASVGIGSNILLARMATRKAKPDGQYHLKPEEVDDFIRGQLVTNLPGVGHSMESKL
ASLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSVSAEINYGI
RFTQPKEAEAFLLSLSEEIQRRLEATGMKGKRLTLKIMVRKPGAPVETAKFGGHGICDNI
TRTVTLDQATDNAKIIGKAMLNMFHTMKLNISDMRGVGIHVNQLVPTNLNPSTCPSRPSV
QSSHFPSGSYSVRDVFQVQKAKKSTEEEHKEVFRAAVDLEISSASRTCTFLPPFPAHLPT
SPDTNKAESSGKWNGLHSPVSVQSRLNLSIEVPSPSQLDQSVLEALPPDLREQVEQFCAV
QQAESHGDKKKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDTGINLIALPAFSQVDPEV
FAALPAELQRELKAAYDQRQRQGENSTHQQSASASVPKNPLLHLKAAVKEKKRNKKKKTI
GSPKRIQSPLKNKLLNSPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPG
LSSLQSDPAGCVRPPAPNLAGAVEFDDVKTLLREWITTISDPMEEDILQVVKYCTDLIEE
KDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Download sequence
Identical sequences G3QH81
ENSGGOP00000001705 ENSGGOP00000001705 XP_004031548.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]