SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001711 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001711
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-41
Family Voltage-gated potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001711   Gene: ENSGGOG00000001737   Transcript: ENSGGOT00000001749
Sequence length 743
Comment pep:known_by_projection chromosome:gorGor3.1:8:131974427:132059088:-1 gene:ENSGGOG00000001737 transcript:ENSGGOT00000001749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRG
RLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKL
LGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEFETYADALWW
GLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFE
KRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAASSQKLGLLDR
VRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSED
AGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQ
YSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPRNEPYVARPS
TSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVQVTEYYPTKGTSSPAEA
EKKEDNRYSDLKTIICNYSETGPPEPPYSFHQVPIDKVSPYGFFAHDPVNLPRGGPSSGK
VQATPPSSATTYMERPTVLPILTLLDSRVSCHSQADLQGLYSDRISPRQRRSITRDSDTP
LSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDTDTDPFTPSG
SMPLSSTGDGISDSVWTPSNKPI
Download sequence
Identical sequences ENSGGOP00000001711 ENSGGOP00000001711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]