SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001713 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001713
Domain Number 1 Region: 59-138
Classification Level Classification E-value
Superfamily Mitochondrial import receptor subunit Tom20 2.09e-27
Family Mitochondrial import receptor subunit Tom20 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001713   Gene: ENSGGOG00000001739   Transcript: ENSGGOT00000001751
Sequence length 152
Comment pep:known_by_projection chromosome:gorGor3.1:14:39249672:39266455:1 gene:ENSGGOG00000001739 transcript:ENSGGOT00000001751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVRSLLGLLAAAAACGGFAFLGYCIYLDRKRRGDPAFKRRLRDKRRAEPQKAEERGTQ
LWDPTKNKKLQELFLQEVRMGELWLSRGEHRMGIQYLGNALLVCEQPRELLKVFKHTLPP
KVFEMLLHKIPLICQQFEADMNEQERLEDDPD
Download sequence
Identical sequences G3QH89
ENSGGOP00000001713 XP_018865566.1.27298 ENSGGOP00000001713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]