SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001727 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001727
Domain Number 1 Region: 76-337,364-403
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.63e-81
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000393
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000000282
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001727   Gene: ENSGGOG00000001752   Transcript: ENSGGOT00000001765
Sequence length 456
Comment pep:known_by_projection chromosome:gorGor3.1:1:112050407:112074221:1 gene:ENSGGOG00000001752 transcript:ENSGGOT00000001765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVL
VFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDD
NSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQ
FEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLE
AWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKRKNNLHLSTQNKLEASLFSPK
KVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQ
EPSKKQKKQHEGSKKKAAARDVTLENRMQNMEVTDA
Download sequence
Identical sequences G3QHA2
ENSGGOP00000001727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]