SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001757 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001757
Domain Number 1 Region: 115-359
Classification Level Classification E-value
Superfamily PA domain 1.57e-79
Family PA domain 0.000000000998
Further Details:      
 
Domain Number 2 Region: 61-108,341-592
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.27e-78
Family FolH catalytic domain-like 0.000000000835
Further Details:      
 
Domain Number 3 Region: 594-654
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 0.0000000000602
Family Transferrin receptor-like dimerisation domain 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001757   Gene: ENSGGOG00000001783   Transcript: ENSGGOT00000001795
Sequence length 656
Comment pep:known_by_projection chromosome:gorGor3.1:11:49860448:49938167:-1 gene:ENSGGOG00000001783 transcript:ENSGGOT00000001795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKIFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRHGIAEAAGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG
TLRGAVEPDRYVILGGHRDSWVFGSIDPQSGAAVVRETVRSFGTLKKEGWRPRRTILFAS
WDAEEFGLLGSTEWAEENSRLLQECGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKE
LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN
WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRYY
AVVLRKYADKIYNISMKHPQEMKTYSVSFDSLFSAVKNFTEISSKFSERLQDFDKS
Download sequence
Identical sequences ENSGGOP00000001757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]