SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001837 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001837
Domain Number 1 Region: 104-147,175-386
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.86e-48
Family Bacterial dinuclear zinc exopeptidases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001837   Gene: ENSGGOG00000001865   Transcript: ENSGGOT00000001877
Sequence length 905
Comment pep:known_by_projection chromosome:gorGor3.1:9:5832441:5881126:-1 gene:ENSGGOG00000001865 transcript:ENSGGOT00000001877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWGSESAAVRRHRVGGERREGAAAAPPPEREARAQEPLVDGCSGGGRTRKRSPGGSGGA
SRGAGTGLSEVRAALGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHIT
SIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYY
DNITNVVVKLEPRDGAQHAVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEALH
HAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQ
AYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTA
DRILTDSIQRAVGDNILAVLKHLATSDMLAAASKYRHGNMVFFDVLGLFVIAYPSRIGSI
INYMVVMGVVLYLGKKFLQPKHKTGNYKKDFLCGLGITLISWFTSLVTVLIIAVFISLIG
QSLSWYNHFYVSVCLYGTATVAKIILIHTLAKRFYYMNASDQYLGEVFFDISLFVHCCFL
VTLTYQGLCSAFISAVWVAFPLLTKLCVHKDFKQHGAQGKFIAFYLLGMFIPYLYALYLI
WAVFEMFTPILGRSGSEIPPDVVLASILAGCTMILSSYFINFIYLAKSTKKTMLTLTLVC
AITFLLVCSGTFFPYSSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGI
SHITPHIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPHFRLIS
KEQTPWDSLKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPVTSKGGDYFVFYSHGLQ
ASAWQFWIEVQVSEEHPEGVVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTY
DLFVF
Download sequence
Identical sequences ENSGGOP00000001837 ENSGGOP00000001837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]