SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001884 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001884
Domain Number 1 Region: 361-545
Classification Level Classification E-value
Superfamily NTF2-like 2.13e-65
Family NTF2-like 0.0000000121
Further Details:      
 
Domain Number 2 Region: 100-190
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.61e-36
Family Non-canonical RBD domain 0.0000047
Further Details:      
 
Domain Number 3 Region: 195-350
Classification Level Classification E-value
Superfamily L domain-like 7.48e-33
Family mRNA export factor tap 0.000000143
Further Details:      
 
Domain Number 4 Region: 542-608
Classification Level Classification E-value
Superfamily UBA-like 1.58e-25
Family TAP-C domain-like 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001884   Gene: ENSGGOG00000001911   Transcript: ENSGGOT00000001925
Sequence length 613
Comment pep:known_by_projection chromosome:gorGor3.1:11:59581753:59593035:-1 gene:ENSGGOG00000001911 transcript:ENSGGOT00000001925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGP
RVRYNPYTTRPNRGVIWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRK
YDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISI
IINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNR
RSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSEREL
DKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTT
LPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPAR
SSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDINSFVVDISAQTST
LLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA
MPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAK
GEIPEVAFKQSPC
Download sequence
Identical sequences ENSGGOP00000001884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]