SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001928 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001928
Domain Number 1 Region: 321-625
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.24e-115
Family Mammalian PLC 0.000000346
Further Details:      
 
Domain Number 2 Region: 161-319
Classification Level Classification E-value
Superfamily EF-hand 4.5e-38
Family EF-hand modules in multidomain proteins 0.014
Further Details:      
 
Domain Number 3 Region: 646-770
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.36e-31
Family PLC-like (P variant) 0.00041
Further Details:      
 
Domain Number 4 Region: 32-145
Classification Level Classification E-value
Superfamily PH domain-like 8.62e-27
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001928   Gene: ENSGGOG00000001959   Transcript: ENSGGOT00000001970
Sequence length 1018
Comment pep:known_by_projection chromosome:gorGor3.1:2b:86462396:86529186:1 gene:ENSGGOG00000001959 transcript:ENSGGOT00000001970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILQDPSNQKCGGRKKTVSFSSMPSEKKISSANDCISFMQAGCELKKVRPNSRIYNRFFTL
DTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGEN
YESLDLVANSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNG
IMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVY
FLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRRYELSEEGRQKGFLAIDGF
TQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYIRALKM
GCRSIELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILCLGNHCSL
PQQKVMVQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDPDVLEGEVTD
EDEEAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDFELSMKSQNYWEMCSFSE
TEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPM
MDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPK
GACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQINLPELAMIRFV
VLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFAHIAITNRSGGGKAQ
KRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCGL
PPIASLKQCLLTLSSRLITSDNTPSVSLVMKDSFPYLEPLGAIPDVQKKMLAAYDLMIQE
SRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQ
GDLLKNAKNEAIENMKQIQLACLSCGLSKAPSSSAEAKSKRSLEAIEEKECSEENGKL
Download sequence
Identical sequences A0A2I2YY88
ENSGGOP00000001928 ENSGGOP00000001928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]