SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001951 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001951
Domain Number 1 Region: 37-361
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.58e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001951   Gene: ENSGGOG00000001980   Transcript: ENSGGOT00000001993
Sequence length 362
Comment pep:known_by_projection chromosome:gorGor3.1:22:3406082:3503214:-1 gene:ENSGGOG00000001980 transcript:ENSGGOT00000001993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDRT
TGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVVTSPDTQKILVDSREATSVPHIYAIGDV
VE
Download sequence
Identical sequences ENSGGOP00000001951 ENSGGOP00000001951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]