SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001964 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001964
Domain Number 1 Region: 26-203
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.29e-60
Family MHC antigen-recognition domain 0.00000000663
Further Details:      
 
Domain Number 2 Region: 206-296
Classification Level Classification E-value
Superfamily Immunoglobulin 9.97e-24
Family C1 set domains (antibody constant domain-like) 0.00000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001964   Gene: ENSGGOG00000001993   Transcript: ENSGGOT00000002006
Sequence length 298
Comment pep:known_by_projection chromosome:gorGor3.1:7:97469334:97478751:-1 gene:ENSGGOG00000001993 transcript:ENSGGOT00000002006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRMVPVLLSLLLLLGPAVPQENQDGHYSLTYIYTGLSKHVEDIPAFQALGSLNDLQFFR
YNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKA
YLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWT
RAGEVQEPELRGDVLHNGNGTYQSWVVVAVPLQDTAPYSCHVQHSSLAQPLVVPWEAS
Download sequence
Identical sequences G3QHX6
ENSGGOP00000001964 ENSGGOP00000001964 XP_004045916.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]