SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001978 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001978
Domain Number 1 Region: 119-422
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.27e-100
Family Pancreatic carboxypeptidases 0.00000368
Further Details:      
 
Domain Number 2 Region: 22-110
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.98e-20
Family Pancreatic carboxypeptidase, activation domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001978   Gene: ENSGGOG00000002007   Transcript: ENSGGOT00000002020
Sequence length 423
Comment pep:known_by_projection chromosome:gorGor3.1:13:28204319:28256115:-1 gene:ENSGGOG00000002007 transcript:ENSGGOT00000002020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTAD
LIMKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYY
EQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQTAKNAIWIDCGI
HAREWISPAFCLWFIGHITQFYGIIGQYTNLLRLVDFYVMPVVNVDGYDYSWKKNRMWRK
NRSFYANNHCVGTDLNRNFASKHWCEEGASSSSCSETYCGLYPESEPEVKAVASFLRRNI
NHIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSE
TLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAISKIAWHVI
RNV
Download sequence
Identical sequences G3QHZ0
ENSGGOP00000001978 ENSGGOP00000001978 XP_004054526.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]