SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001981 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001981
Domain Number 1 Region: 2-125,240-343,749-990
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.05e-144
Family Calcium ATPase, transmembrane domain M 0.0000000000486
Further Details:      
 
Domain Number 2 Region: 356-598
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 2.55e-62
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0000000187
Further Details:      
 
Domain Number 3 Region: 583-748
Classification Level Classification E-value
Superfamily HAD-like 5.02e-47
Family Meta-cation ATPase, catalytic domain P 0.00000118
Further Details:      
 
Domain Number 4 Region: 134-237
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.48e-28
Family Calcium ATPase, transduction domain A 0.00000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001981   Gene: ENSGGOG00000002006   Transcript: ENSGGOT00000002023
Sequence length 1051
Comment pep:known_by_projection chromosome:gorGor3.1:17:3942519:3999674:-1 gene:ENSGGOG00000002006 transcript:ENSGGOT00000002023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAHLLSAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNIASGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAHESVIERCSSVRVGSRTAPTPTS
REQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYNTDLTFVGCVGMLD
PPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDDL
SPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKSAAEMVLSDDNFASIVATVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAIL
GLPGALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAIG
VYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFKSRFPTTMAL
SVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLAAVAMSMALHFLILLVPPLPLIFQVTP
LSGRQWVVVLQISLPVILLDEALKYLSRNHIHACLYPGILRTVSQAWSRQPLTTSWTPDH
TGLASLGQGHSIVSLSELLREGGSRGEMAQR
Download sequence
Identical sequences ENSGGOP00000001981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]