SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001993 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001993
Domain Number 1 Region: 202-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-35
Family APC10-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1819-1879
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000553
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1777-1828
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000683
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 93-159
Classification Level Classification E-value
Superfamily EF-hand 0.00000187
Family Polcalcin 0.061
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001993
Domain Number - Region: 1102-1191
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00327
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number - Region: 2655-2744
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0183
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001993   Gene: ENSGGOG00000002015   Transcript: ENSGGOT00000002035
Sequence length 2910
Comment pep:known_by_projection chromosome:gorGor3.1:17:4046730:4185361:-1 gene:ENSGGOG00000002015 transcript:ENSGGOT00000002035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSHSSEDEAAAAGGEGWGPHQDWAAVSGTTPGPGLAAPALPPAAALLEPARLREAA
AALLPTPPCESLVSRHRGALFRWLEERLGRGEESVTLEQFRELLEARGAGCSSEQFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFTDIFSESKEGLD
IHSSMILRFLHRNRLSSAVMPYPMLEHCNNMCTMRSSVLKESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSACSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRNASDLQEVRDVHIPSNVTGYVTLLENANVSQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLHNTQKALRHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFA
LARGSVAKVMSSLCTITDHLDTQYDASSLILSMASVRQNLLLKYGKPLQLTLQACDVKGK
EDKSGPENLLVEPWTRDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFCAEEHFKRFEKYDKWKLQELRQFVKSRIGCSSDDLGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLTISGYLRPARAEAEQSVTCAHCR
KDTEESVCGATLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKR
NPREECISAQTLLLQLLQSCFSVLQGDVLAASEEEKAPIQSPKGVEAAKELYTHLCDVVD
KVDGDSVPMEILKQEVRNTLLNGAAIFFPNRQTRRNHLFTMMNVTEQEHKQSLQLTFRSL
CTYFSDKDPGGLLLLPEKNDLAKMNISEVLVVMDTLVSVAARECELLMLSGAPGEVGSVL
FSLFWSVQGSLLSWCYLQLKSTDSGAKDLAVDLIEKYVGQFLASMRAILESLLSQYGGKT
IVERLCNSVFSMAARQLVIFLLDFCTLDIPHCVLLREFSVLTELLKKLCSGPEGGLRKLD
VETWQQEQPVVLHTWTKESAHNYENNCHEVSVFVSPGATYFEVEFDDRCETEKRYDYLEF
TDARGRKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSHNEWGYKFTVTACGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVRQLGSNMVVPQAKMALVLSSPLWKPVFRHQVCP
ELELEASWPTHPRRNSKEVKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKIALSEEFAQVYSLADG
IRIWMLEMKQKSLMSLGNEAEEKHSSEATEVNPESLAKECIEKSLLLLKFLPTGISSKES
CEKLETADETSHLQPLNKRQRTSSVVEEHFQASISPTEAAPPATGDRSPGLDTQPKLPSS
SGLPAADVSPATAEEPLSPSTPTRRPPFTRGRLRLLSFRSMEEARLVPTVKERYPVLKDV
MDFIKDQSLSHRSVVKVLSLRKAQAQSILEVLKITQYCAESLGQPHCFHPPFILFLLELL
TCQKDFTNYFGHLEGCGADLHKEIRDTYYQLVLFLVKAVKGFSSLNDRSLLPALSCVQTA
LLHLLDMGWEPSDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWM
DECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQC
SDMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYA
AKKYSYGHLPTHSITAHPMVTIRISDRQRLIQPYIHNYSWLLFAALALYSAHLASAEDVD
GEKLDPQTRSSATTLRSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGDSSPEDQALPVT
VPTGASEEQLEKKAAQGAELSEAGNAEDSEVSSQKPIEEKAVTPSPEQVFAECSQKRILG
LLAAMLPPLKSGPTVPLIDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLLPAE
VDAAVIKVLSAKHNLFAAGDSSIVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRS
LNSAPLWRDVIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPH
NVIILKHFTEKNRAVIVDVKTRKRKTVKDYQLVQKGGGQECGDSRAQLSQYSQHFAFIAS
HLLQSSMDSHCPEAVEATWVLSLALKGLYKTLKAHGFEETHATFLQTDLLKLLVKKCSKG
TGFSKTWLLRDLEILSIMLYSSKKEISALAEHGDLQLDERGDREEEVERPVSSPGDPEQK
KLDPLEGLDEPTRICFLMAHDALNAPLHILRAIYELQMKKTDYFFLEVQKRFDGDELTTD
ERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPALCDQATAESNPVTQKLISST
ESELQQSYAKQRRSKSAALLHKELNCKSKRAVRDYLFRVNEATAVLYARHVLASLLAEWP
SHVPVSEDILELSGPAHMTYILDMFMQLEEKHEWEKILQKVLQGCREDMLGTMALAACQF
MEEPGMEVQVRESKHPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTEEGCDELAMSSSSDF
QQDRHSFSGSQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLGRFQTGFEILKQ
MLSEERVVPHLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVRCCGHSDLCDLALLKPL
WQLFTHMEYGLFEDVTQPGILLPLHRALTELFFVTENRAQELGVLQDYLLALTTDDHLLR
CAAQALQNIAAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences ENSGGOP00000001993 ENSGGOP00000001993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]