SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002000 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002000
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-29
Family C-type lectin domain 0.000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002000   Gene: ENSGGOG00000002031   Transcript: ENSGGOT00000002042
Sequence length 222
Comment pep:known_by_projection chromosome:gorGor3.1:11:54102896:54106694:-1 gene:ENSGGOG00000002031 transcript:ENSGGOT00000002042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCWELEEEEEW
GSGSEDASKKDGAVESISLPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
AWFTCRRCYRGNLASIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRHFQWVDGSRW
NFAYWAARQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Download sequence
Identical sequences G3QI07
XP_004051206.1.27298 XP_004051207.1.27298 XP_018892705.1.27298 XP_018892706.1.27298 ENSGGOP00000002000 ENSGGOP00000002000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]