SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002018 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002018
Domain Number 1 Region: 37-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-23
Family Laminin G-like module 0.089
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002018
Domain Number - Region: 355-502
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0608
Family DPP6 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002018   Gene: ENSGGOG00000002047   Transcript: ENSGGOT00000002061
Sequence length 673
Comment pep:known_by_projection chromosome:gorGor3.1:21:33157674:33383576:-1 gene:ENSGGOG00000002047 transcript:ENSGGOT00000002061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLCFVLPLVAPGHGTQGWEPCTDLRPLDILAEVVPSDGATSGIRIVQVHGARGLQ
LSAAAPRTMSFPASRIFSRCDLFPEEFSIVVTLRVPSLPPKRNEYLLTVVAEESDLLLLG
LRFSPAQLHFLFLREDTAGAWQTRVSFRSPALVDSRWHTLVLAVSAGVFSLTTDCGLPVD
IMADVPFPARLSVKGARFFVGSRRRAKGLFTATGLVRQLVLLPGSDATPRLCPSRNAPLA
VLSIPRVLQALTGKPEDNEVLKYPYETNIRVTLGPQPPCTEVEDAQFWFDASRKGLYLCV
GNEWVSVLAAKERLDYVEEHQNLFTNSETLGVEVFRIPQVGLFVATANRKATSAVYKWTE
EKFVSYQNIPTHQAQAWRHFTIGKKATIFLAVANFEPDEKGQEFSVIYKWSHRKLKFTPY
QSIATHSARDWEAFEVDGEHFLAVANHREGDNHNINSVIYKWNPATRLFEANQTIATSGA
YDWEFFSVGPYSFLVVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGAADWEVFQIGE
RIFLAVANSHSYDVEMQVQNDSYVINSVIYELNVTAQAFVKFQDILTCSALDWEFFSVGE
DYFLVVANSFDGRTFSVNSIIYRWQGYEGFVAVHSLPTVGCRDWEAFSTTAGAYLIYSSA
KEPLSRVLRLRTR
Download sequence
Identical sequences ENSGGOP00000002018 ENSGGOP00000025560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]