SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002021 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002021
Domain Number 1 Region: 26-453
Classification Level Classification E-value
Superfamily Ras GEF 1.23e-102
Family Ras GEF 0.00041
Further Details:      
 
Domain Number 2 Region: 514-582
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 361-380,449-519
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000285
Family Calmodulin-like 0.036
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002021
Domain Number - Region: 737-773
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.051
Family Mitotic arrest deficient-like 1, Mad1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002021   Gene: ENSGGOG00000002051   Transcript: ENSGGOT00000002064
Sequence length 787
Comment pep:known_by_projection chromosome:gorGor3.1:15:16895871:16969741:-1 gene:ENSGGOG00000002051 transcript:ENSGGOT00000002064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCI
QSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYPDALAKNSPGLCLKICYFVR
YWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSN
TSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIAL
CNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLK
ETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMP
DYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELS
YAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYI
SQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYL
KPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGP
VSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAH
KATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENK
DSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQ
MEQGDCS
Download sequence
Identical sequences ENSGGOP00000002021 ENSGGOP00000002021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]