SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002030 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002030
Domain Number 1 Region: 1349-1820
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.45e-162
Family Family 1 of glycosyl hydrolase 0.0000000143
Further Details:      
 
Domain Number 2 Region: 875-1336
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.32e-159
Family Family 1 of glycosyl hydrolase 0.00000000424
Further Details:      
 
Domain Number 3 Region: 347-816
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.2e-144
Family Family 1 of glycosyl hydrolase 0.0000000512
Further Details:      
 
Domain Number 4 Region: 34-214
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.72e-29
Family Family 1 of glycosyl hydrolase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002030   Gene: ENSGGOG00000002058   Transcript: ENSGGOT00000002073
Sequence length 1900
Comment pep:known_by_projection chromosome:gorGor3.1:2b:22888796:22939353:-1 gene:ENSGGOG00000002058 transcript:ENSGGOT00000002073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKD
MYVCHQPLPTFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLEAL
KTARLQPMVILHHQTLPASTLQRTEAFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIK
ELPHQESRASQLQTLSDAHRKAYEIYHENYASQDAVDFLSLDLSYECQNEASLRQKLSKL
QTIEPKVKVFIFNLKLPDCPSTMKNQASLLFSLFEAINKDQVLTIGFDINEFLSCSSSSK
KSMSCSLTGSLALQPDQQQDHETTDSSPASAYQRVWEAFANQSRVERDAFLQDTFPEGFL
WGASTGAFNVEGGWAEGGRGASIWDPCRPLNTTEGQATPEVASDSYHKVASDVALLRGLR
AQVYKFSISWSRIFPMGHGSSPSLPGVAYYNKLIDRLQDAGIEPMATLFHWDLPQALQDH
GGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTFHEPWVMSYAGYGTGQHPPGISDPGVAS
FKVAHLVLKAHARTWHHYNSHHRPQQQGHVGIVLNSDWAEPLSPERPEDLRASERFLHFM
LGWFAHPIFVDGDYPATLRTQIQQMNGQCSHPVAQLPEFTEAEKQLLKGSADFLGLSHYT
SRLISNAPQNTCIPSYDTIGGFSQHVNHVWPQTSSSWIRVVPWGIRRLLQFVSLEYTRGK
VPIYLAGNGMPIGESENLFDDSLRVDYFNQYINEVLKAIKEDSVDVRSYIARSLIDGFEG
PSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFTSIIEKNGFLTKGAKRLLPPNMANLPSKV
RAFTFPSEVPSKAKVVWEKFSSQPKFERDLFYHGTFRDDFLWGVSSSAYQIEGGWDADGK
GPSIWDNFTHTPGSNVKDNATGDIACDSYHQLDADLNMLRALKVKAYRFSISWSRIFPTG
RNSSINSHGVDYYNRLINGLVASNIFPMVTLFHWDLPQALQDIGGWENPALIDLFDSYAD
FCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEFPPGVKDPGWAPYRIAHAVIKAHARVYHT
YDEKYRQEQKGVISLSLSTHWAEPKSPGVPRDVEAADRMLQFSLGWFAHPIFRNGDYPDT
MKWKVGNRSELQHLATSRLPSFTEEEKRFIRATADVFCLNTYYSRIVQHKTPRLNPPSYE
DDREMAEEEDPSWPSTAMNRAAPWGTRRLLNWIKEEYGDIPIYITENGVGLTDPNTEDTD
RIFYHKTYINEALKAYRLDGVDLRGYVAWSLMDNFEWLNGYTVKFGLYHVDFNNMNRPRT
ARASARYYTEVITNNGMPLAREDEFLYGRFPEGFIWSAASAAYQIEGAWRADGKGLSIWD
TFSHTPLKVEDDAIGDVACDSYHKIAEDLVTLQNLGVSHYRFSISWSRILPDGTTRYINE
AGLNYYVRLIDTLLAASIQPQVTIYHWDLPQTLQDVGGWENETIVQRFKEYADVLFRRLG
DKVKFWITLNEPFVIAYQGYGYGTAAPGISNRPGTAPYIVGHNLIKAHAEAWHLYNDVYR
ASQGGVISITISSDWAEPRDPSNQEDVEAARRYVQFMGGWFAHPIFKNGDYNEVMKTRIR
DRSLAAGLNKSRLPEFTESEKRRINGTYDFFGFNHYTTVLAYNLNYATAISSFDADRGVA
SIADRSWPDSGSLWLKMTPFGFRRILNWLKEEYNDPPIYVTENGVSQREETDLNDTARIY
YLRAYINEALKAVQDKVDLRGYTVWSAMDNFEWATGFSERFGLHFVNYSDPSLPRIPKAS
AKFYASVVRCNGFPDPATGPHACLHQPDAGPTISPVRQEEVQFLGLMLGTAEAQTALYVL
FSLVLLGVCGLAFLSYKYCKGSKQGKTQRSQQELSPVSSF
Download sequence
Identical sequences ENSGGOP00000002030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]