SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002103 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002103
Domain Number 1 Region: 51-173,206-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-21
Family Nucleotide and nucleoside kinases 0.0015
Further Details:      
 
Domain Number 2 Region: 263-418
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000134
Family Nucleotide and nucleoside kinases 0.01
Further Details:      
 
Domain Number 3 Region: 172-200
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.000000513
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002103
Domain Number - Region: 8-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002103   Gene: ENSGGOG00000002135   Transcript: ENSGGOT00000002148
Sequence length 426
Comment pep:known_by_projection chromosome:gorGor3.1:9:116325984:116480338:-1 gene:ENSGGOG00000002135 transcript:ENSGGOT00000002148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRIVILGP
PASGKTTIAMWLCKHLNSSLLTLENLILNEFSYTATEARRLYLQRKTVPSALLVQLIQER
LAEEDCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTG
EIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQP
CVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKE
AVADRTTFGELIQPFFEKEMAVFFLNVPFDSIMERLTLRRVDPVTGERYHLMYKPPPTME
IQARLLQNPKDAEEQVKLKMDLFYRNLADLEQLYGSAITLNGDQDPYTVFEYIESGIINP
LPKKIP
Download sequence
Identical sequences ENSGGOP00000002103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]