SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002113 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002113
Domain Number 1 Region: 50-217
Classification Level Classification E-value
Superfamily FMN-binding split barrel 4.36e-43
Family PNP-oxidase like 0.0000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002113   Gene: ENSGGOG00000002145   Transcript: ENSGGOT00000002158
Sequence length 220
Comment pep:known_by_projection chromosome:gorGor3.1:1:146723282:146734598:-1 gene:ENSGGOG00000002145 transcript:ENSGGOT00000002158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVAR
FVTHVSDWGALATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLREN
PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKT
WPSSHNWFFAKLNITNIWVLDYFGGPKIVTPEEYYNVTVQ
Download sequence
Identical sequences G3QIA8 K7CBH9
XP_003824648.1.60992 XP_004027891.1.27298 XP_009435718.2.37143 ENSGGOP00000002113 ENSGGOP00000002113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]