SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002142 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002142
Domain Number 1 Region: 18-78
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000105
Family SNARE fusion complex 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002142   Gene: ENSGGOG00000002176   Transcript: ENSGGOT00000002188
Sequence length 83
Comment pep:known_by_projection chromosome:gorGor3.1:7:91255426:91265865:-1 gene:ENSGGOG00000002176 transcript:ENSGGOT00000002188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQ
NKLLAEMDSQFDSTTGFLVLCPM
Download sequence
Identical sequences G3QID6
ENSGGOP00000002142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]