SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002166 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002166
Domain Number 1 Region: 488-551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000862
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 416-462
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000981
Family TSP-1 type 1 repeat 0.00077
Further Details:      
 
Domain Number 3 Region: 543-599
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000264
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000119
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002166
Domain Number - Region: 368-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00691
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002166   Gene: ENSGGOG00000002197   Transcript: ENSGGOT00000002212
Sequence length 760
Comment pep:known_by_projection chromosome:gorGor3.1:17:52669294:52745010:-1 gene:ENSGGOG00000002197 transcript:ENSGGOT00000002212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVISLFILVGFIGEFQSFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFTKRVINTKSFGGQCRRVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSRSYTSHNNE
IHKGKFNSVEEKKCKSSGWHFFVKFSSHGCKELENALKAASGTQNNVLRGDQFISGGSEG
LISGLSYLELDNPAGNKRRYSAWAESVTNLPEVIKQKLTPLYELVKEVPCASVKKLYLKW
ALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGW
SCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCIGETIESTQCEDEELEHLRLLEPHCFPL
SLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGE
MHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEM
KNARCVQKENLLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCARDERSKRILPLTVC
KMHVLHCQGRNYTLTGRDSCTLSASAEKACGACPLWGKCDAESSKCVCREASECEEEGFS
ICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ
Download sequence
Identical sequences G3QIF7
ENSGGOP00000002166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]