SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002204 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002204
Domain Number 1 Region: 174-432
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-74
Family Nuclear receptor ligand-binding domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 100-186
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-30
Family Nuclear receptor 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002204   Gene: ENSGGOG00000002238   Transcript: ENSGGOT00000002251
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:14:57679409:57783283:1 gene:ENSGGOG00000002238 transcript:ENSGGOT00000002251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPP
MFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKAL
TTLCDLADRELVVIIGWAKHIPGFSNLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLV
YAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDL
EAVQKLQDLLHEALQDYELSQRHEEPRRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKVGQEQLRGSPKDERVSSHDGKCPFQSAAFTSRDQSNPPGIPNPRPSSP
TPLSERGRQISPSTRTPGGQGKHFWLTM
Download sequence
Identical sequences A0A2I2Y1Q8
ENSGGOP00000002204 ENSGGOP00000002204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]